### Check Biopython Installation

Source: https://biopython.org/wiki/Documentation/wiki/Getting_Started

Verify if Biopython is correctly installed by attempting to import the Bio module. An ImportError indicates a problem with the installation.

```Python
import Bio
```

--------------------------------

### Install Biopython from local source directory using pip

Source: https://biopython.org/wiki/Documentation/wiki/Download

Installs Biopython from the current directory, assuming it contains the source code. This is an alternative to `setup.py install` for installing local packages.

```Bash
pip install .
```

--------------------------------

### Install Biopython on FreeBSD using Ports

Source: https://biopython.org/wiki/Documentation/wiki/Packages

Install Biopython on FreeBSD systems using the Ports Collection. This command navigates to the port directory and initiates the build and installation process.

```Shell
cd /usr/ports/biology/py-biopython
make install clean
```

--------------------------------

### Build and install Biopython from source using setup.py

Source: https://biopython.org/wiki/Documentation/wiki/Download

Compiles, tests, and installs Biopython from its source code using the traditional `setup.py` script. This method requires a C compiler and Python development headers.

```Bash
python setup.py build
python setup.py test
python setup.py install
```

--------------------------------

### Install Biopython on Gentoo using emerge

Source: https://biopython.org/wiki/Documentation/wiki/Packages

Install Biopython on Gentoo Linux using the emerge package manager from the portage tree.

```Shell
emerge -va biopython
```

--------------------------------

### Install and Test Biopython from Source Tarball

Source: https://biopython.org/wiki/Documentation/wiki/Building_a_release

This snippet shows how to install the extracted Biopython source distribution into a temporary prefix and then run its comprehensive test suite. This step ensures the integrity and functionality of the distributed package, with common failures indicating missing example files in `MANIFEST.in`.

```bash
python -m pip install .  --prefix /tmp/test-install
cd Tests && python run_tests.py
```

--------------------------------

### Install Biopython on Ubuntu or Debian using apt-get

Source: https://biopython.org/wiki/Documentation/wiki/Packages

Install Biopython and its dependencies on Ubuntu or Debian systems using apt-get. Separate commands are provided for the core library, documentation, unit tests, and BioSQL support.

```Shell
sudo apt-get install python-biopython
```

```Shell
sudo apt-get install python-biopython-doc
```

```Shell
sudo apt-get install python-biopython-sql
```

```Shell
sudo apt-get build-dep python-biopython
```

--------------------------------

### Biopython 1.70 Release Downloads

Source: https://biopython.org/wiki/Documentation/wiki/Download

Download options for Biopython version 1.70, including source code archives, PyPI wheels, and the tutorial PDF.

```APIDOC
Biopython 1.70:
  Source Tarball: http://biopython.org/DIST/biopython-1.70.tar.gz (15Mb, 11 July 2017)
  Source Zip: http://biopython.org/DIST/biopython-1.70.zip (16Mb)
  PyPI Wheels: https://pypi.python.org/pypi/biopython/1.70
  Tutorial PDF: http://biopython.org/DIST/docs/tutorial/Tutorial-1.70.pdf
```

--------------------------------

### Demonstrate Biopython Seq Object and Methods

Source: https://biopython.org/wiki/Documentation/wiki/Getting_Started

Illustrates basic usage of Biopython's Seq object. It creates a sequence, then prints its length, reverse complement, and protein translation, showcasing fundamental sequence manipulation.

```Python
from Bio.Seq import Seq

# create a sequence object
my_seq = Seq("CATGTAGACTAG")

# print out some details about it
print("seq %s is %i bases long" % (my_seq, len(my_seq)))
print("reverse complement is %s" % my_seq.reverse_complement())
print("protein translation is %s" % my_seq.translate())
```

--------------------------------

### Biopython 1.71 Release Downloads

Source: https://biopython.org/wiki/Documentation/wiki/Download

Download options for Biopython version 1.71, including source code archives, PyPI wheels, and the tutorial PDF.

```APIDOC
Biopython 1.71:
  Source Tarball: http://biopython.org/DIST/biopython-1.71.tar.gz (16Mb, 4 April 2018)
  Source Zip: http://biopython.org/DIST/biopython-1.71.zip (17Mb)
  PyPI Wheels: https://pypi.python.org/pypi/biopython/1.71
  Tutorial PDF: http://biopython.org/DIST/docs/tutorial/Tutorial-1.71.pdf
```

--------------------------------

### Biopython 1.72 Release Downloads

Source: https://biopython.org/wiki/Documentation/wiki/Download

Download options for Biopython version 1.72, including source code, PyPI wheels, and the tutorial PDF.

```APIDOC
Biopython 1.72:
  Source Zip: http://biopython.org/DIST/biopython-1.72.zip (17Mb)
  PyPI Wheels: https://pypi.python.org/pypi/biopython/1.72
  Tutorial PDF: http://biopython.org/DIST/docs/tutorial/Tutorial-1.72.pdf
```

--------------------------------

### Install Xcode command line tools on macOS

Source: https://biopython.org/wiki/Documentation/wiki/Download

Installs Apple's command line developer tools, which are required for compiling Biopython from source on macOS. This command initiates the installation process.

```Bash
xcode-select --install
```

--------------------------------

### Install Biopython using pip

Source: https://biopython.org/wiki/Documentation/wiki/Packages

Recommended method to install Biopython using Python's package manager pip. This command installs the core Biopython library.

```Shell
pip install biopython
```

--------------------------------

### Install Biopython using pip

Source: https://biopython.org/wiki/Documentation/wiki/Download

Installs the latest stable version of Biopython using the Python package installer, pip. This is the recommended method for most users.

```Bash
pip install biopython
```

--------------------------------

### Biopython 1.69 Release Downloads

Source: https://biopython.org/wiki/Documentation/wiki/Download

Download options for Biopython version 1.69, including source code, various 32-bit Windows installers for Python 2.7, 3.3, 3.4, 3.5, 3.6, and the tutorial PDF.

```APIDOC
Biopython 1.69:
  Source Tarball: http://biopython.org/DIST/biopython-1.69.tar.gz (15Mb, 7 April 2017)
  Source Zip: http://biopython.org/DIST/biopython-1.69.zip (16Mb)
  Windows Installers (32-bit):
    Python 2.7: .exe (2Mb) http://biopython.org/DIST/biopython-1.69.win32-py2.7.exe, .msi (2Mb) http://biopython.org/DIST/biopython-1.69.win32-py2.7.msi
    Python 3.3: .exe (2Mb) http://biopython.org/DIST/biopython-1.69.win32-py3.3.exe, .msi (2Mb) http://biopython.org/DIST/biopython-1.69.win32-py3.3.msi
    Python 3.4: .exe (2Mb) http://biopython.org/DIST/biopython-1.69.win32-py3.4.exe, .msi (2Mb) http://biopython.org/DIST/biopython-1.69.win32-py3.4.msi
    Python 3.5: .exe (3Mb) http://biopython.org/DIST/biopython-1.69.win32-py3.5.exe, .msi (3Mb) http://biopython.org/DIST/biopython-1.69.win32-py3.5.msi
    Python 3.6: .exe (2Mb) http://biopython.org/DIST/biopython-1.69.win32-py3.6.exe, .msi (2Mb) http://biopython.org/DIST/biopython-1.69.win32-py3.6.msi
  Tutorial PDF: http://biopython.org/DIST/docs/tutorial/Tutorial-1.69.pdf
```

--------------------------------

### Install Biopython on Windows using full pip path

Source: https://biopython.org/wiki/Documentation/wiki/Download

Demonstrates how to install Biopython on Windows by providing the full path to the pip executable. This is necessary if Python and pip are not added to the system's PATH environment variable.

```Bash
C:\Python39\Scripts\pip install biopython
```

--------------------------------

### Launch IPython with Matplotlib integration

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_phylo

Start the IPython interpreter with the `-pylab` flag to enable `matplotlib` integration. This setup allows graphics to pop up automatically, which is useful for interactive visualization during the demo.

```Bash
$ ipython -pylab
```

--------------------------------

### Run all Biopython tests during setup

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_testing

This command executes the entire Biopython test suite as part of the `setup.py` build and installation process. It's typically run from the top-level Biopython source directory to ensure all components are working correctly.

```Shell
python setup.py test
```

--------------------------------

### Biopython 1.68 Release Downloads

Source: https://biopython.org/wiki/Documentation/wiki/Download

Download options for Biopython version 1.68, including source code, various 32-bit Windows installers for Python 2.6, 2.7, 3.3, 3.4, 3.5, and the tutorial PDF.

```APIDOC
Biopython 1.68:
  Source Tarball: http://biopython.org/DIST/biopython-1.68.tar.gz (14Mb, 26 August 2016)
  Source Zip: http://biopython.org/DIST/biopython-1.68.zip (15Mb)
  Windows Installers (32-bit):
    Python 2.6: .exe (2Mb) http://biopython.org/DIST/biopython-1.68.win32-py2.6.exe
    Python 2.7: .exe (2Mb) http://biopython.org/DIST/biopython-1.68.win32-py2.7.exe, .msi (2Mb) http://biopython.org/DIST/biopython-1.68.win32-py2.7.msi
    Python 3.3: .exe (2Mb) http://biopython.org/DIST/biopython-1.68.win32-py3.3.exe, .msi (2Mb) http://biopython.org/DIST/biopython-1.68.win32-py3.3.msi
    Python 3.4: .exe (2Mb) http://biopython.org/DIST/biopython-1.68.win32-py3.4.exe, .msi (2Mb) http://biopython.org/DIST/biopython-1.68.win32-py3.4.msi
    Python 3.5: .exe (2Mb) http://biopython.org/DIST/biopython-1.68.win32-py3.5.exe, .msi (2Mb) http://biopython.org/DIST/biopython-1.68.win32-py3.5.msi
  Tutorial PDF: http://biopython.org/DIST/docs/tutorial/Tutorial-1.68.pdf
```

--------------------------------

### Biopython 1.67 Release Downloads

Source: https://biopython.org/wiki/Documentation/wiki/Download

Download options for Biopython version 1.67, including source code archives.

```APIDOC
Biopython 1.67:
  Source Tarball: http://biopython.org/DIST/biopython-1.67.tar.gz (14Mb, 8 June 2016)
  Source Zip: http://biopython.org/DIST/biopython-1.67.zip (15Mb)
```

--------------------------------

### Example Fasta File Content

Source: https://biopython.org/wiki/Documentation/wiki/SeqIO

Shows an example of the resulting Fasta file content after conversion, highlighting the identifier, description, and sequence lines.

```Text
>X55053.1 A.thaliana cor6.6 mRNA.
AACAAAACACACATCAAAAACGATTTTACAAGAAAAAAATA...
...
```

--------------------------------

### Install Git on Ubuntu/Debian Linux

Source: https://biopython.org/wiki/Documentation/wiki/GitUsage

This command installs the 'git-core' package on Ubuntu or Debian-based Linux distributions using the apt-get package manager. It is the recommended way to get Git on these systems.

```bash
sudo apt-get install git-core
```

--------------------------------

### Install Biopython on Archlinux using pacman

Source: https://biopython.org/wiki/Documentation/wiki/Packages

Install Biopython for Python 2 or Python 3 on Archlinux using the pacman package manager from the official repository.

```Shell
pacman -S python2-biopython
```

```Shell
pacman -S python-biopython
```

--------------------------------

### Install Biopython Python Package via pip

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_introduction

This command-line snippet shows the recommended way to install the Biopython library. Using `pip`, Python's package installer, ensures that Biopython and its dependencies are correctly downloaded and set up in your environment, making all its functionalities available for use.

```Shell
pip install biopython
```

--------------------------------

### FASTQ Parsing Edge Case Example (Raw)

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.SeqIO.QualityIO

Provides an example of a FASTQ header line, illustrating a potential issue where the "@" character can appear in the quality string, which might conflict with the start of a new sequence.

```FASTQ
@071113_EAS56_0053:1:1:998:236
```

--------------------------------

### Example BWA MEM Command Line Usage in Biopython

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Sequencing.Applications

Demonstrates how to initialize and print a BwaMemCommandline object for aligning reads to a reference genome using Biopython. It shows the basic setup for a single-end alignment command.

```Python
from Bio.Sequencing.Applications import BwaMemCommandline
reference_genome = "/path/to/reference_genome.fasta"
read_file = "/path/to/read_1.fq"
output_sam_file = "/path/to/output.sam"
align_cmd = BwaMemCommandline(reference=reference_genome, read_file1=read_file)
print(align_cmd)
```

--------------------------------

### Python Example: Initializing SamtoolsCalmdCommandline

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Sequencing.Applications

A Python code example demonstrating how to import and instantiate the SamtoolsCalmdCommandline class. It shows how to pass input BAM and reference FASTA file paths to construct the command line, which can then be printed.

```Python
from Bio.Sequencing.Applications import SamtoolsCalmdCommandline
input_bam = "/path/to/aln.bam"
reference_fasta = "/path/to/reference.fasta"
calmd_cmd = SamtoolsCalmdCommandline(input_bam=input_bam,
                                     reference=reference_fasta)
print(calmd_cmd)
```

--------------------------------

### Build Biopython Documentation PDF

Source: https://biopython.org/wiki/Documentation/wiki/Building_a_release

This snippet details the steps to install Sphinx requirements, build the Biopython documentation as a PDF, copy the generated PDF to the Doc directory, and clean up build artifacts. This process requires `latexmk` and other LaTeX tools to be installed.

```bash
pip install -r .circleci/requirements-sphinx.txt
make -C Doc latexpdf
cp Doc/_build/latex/Biopython_doc.pdf Doc/
make clean -C Doc
```

--------------------------------

### Print Biopython BLAST Records for Overview

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_blast

This example demonstrates how to quickly get a summary of the parsed BLAST records by simply printing the `blast_records` object. The output provides a concise overview including the BLAST program, database, query details, and a list of top hits with their descriptions.

```Python
>>> from Bio import Blast
>>> with Blast.parse("my_blast.xml") as blast_records:
...     print(blast_records)
...
Program: BLASTN 2.2.27+
     db: refseq_rna

  Query: 42291 (length=61)
         mystery_seq
   Hits: ----  -----  ----------------------------------------------------------
            #  # HSP  ID + description
         ----  -----  ----------------------------------------------------------
            0      1  gi|262205317|ref|NR_030195.1|  Homo sapiens microRNA 52...
            1      1  gi|301171311|ref|NR_035856.1|  Pan troglodytes microRNA...
            2      1  gi|270133242|ref|NR_032573.1|  Macaca mulatta microRNA ...
            3      2  gi|301171322|ref|NR_035857.1|  Pan troglodytes microRNA...
            4      1  gi|301171267|ref|NR_035851.1|  Pan troglodytes microRNA...
            5      2  gi|262205330|ref|NR_030198.1|  Homo sapiens microRNA 52...
            6      1  gi|262205302|ref|NR_030191.1|  Homo sapiens microRNA 51...
            7      1  gi|301171259|ref|NR_035850.1|  Pan troglodytes microRNA...
            8      1  gi|262205451|ref|NR_030222.1|  Homo sapiens microRNA 51...
            9      2  gi|301171447|ref|NR_035871.1|  Pan troglodytes microRNA...
           10      1  gi|301171276|ref|NR_035852.1|  Pan troglodytes microRNA...
           11      1  gi|262205290|ref|NR_030188.1|  Homo sapiens microRNA 51...
           12      1  gi|301171354|ref|NR_035860.1|  Pan troglodytes microRNA...
           13      1  gi|262205281|ref|NR_030186.1|  Homo sapiens microRNA 52...
           14      2  gi|262205298|ref|NR_030190.1|  Homo sapiens microRNA 52...
           15      1  gi|301171394|ref|NR_035865.1|  Pan troglodytes microRNA...
           16      1  gi|262205429|ref|NR_030218.1|  Homo sapiens microRNA 51...
           17      1  gi|262205423|ref|NR_030217.1|  Homo sapiens microRNA 52...
           18      1  gi|301171401|ref|NR_035866.1|  Pan troglodytes microRNA...
           19      1  gi|270133247|ref|NR_032574.1|  Macaca mulatta microRNA ...
           20      1  gi|262205309|ref|NR_030193.1|  Homo sapiens microRNA 52...
           21      2  gi|270132717|ref|NR_032716.1|  Macaca mulatta microRNA ...
           22      2  gi|301171437|ref|NR_035870.1|  Pan troglodytes microRNA...
           23      2  gi|270133306|ref|NR_032587.1|  Macaca mulatta microRNA ...
           24      2  gi|301171428|ref|NR_035869.1|  Pan troglodytes microRNA...
           25      1  gi|301171211|ref|NR_035845.1|  Pan troglodytes microRNA...
           26      2  gi|301171153|ref|NR_035838.1|  Pan troglodytes microRNA...
           27      2  gi|301171146|ref|NR_035837.1|  Pan troglodytes microRNA...
```

--------------------------------

### Example Sanger FASTQ File Content

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.SeqIO.QualityIO

An example of a Sanger-style FASTQ file containing three short reads, demonstrating the sequence and corresponding PHRED quality strings.

```text
@EAS54_6_R1_2_1_413_324
CCCTTCTTGTCTTCAGCGTTTCTCC
+
;;3;;;;;;;;;;;;7;;;;;;;88
@EAS54_6_R1_2_1_540_792
TTGGCAGGCCAAGGCCGATGGATCA
+
;;;;;;;;;;;7;;;;;-;;;3;83
@EAS54_6_R1_2_1_443_348
GTTGCTTCTGGCGTGGGTGGGGGGG
+
;;;;;;;;;;;9;7;;.7;393333
```

--------------------------------

### Test Git Installation

Source: https://biopython.org/wiki/Documentation/wiki/GitUsage

This command is used to verify that Git has been successfully installed on your system. Running it should display the Git help message, indicating that the 'git' command is recognized and executable.

```bash
git --help
```

--------------------------------

### Bio.Emboss.Applications.SeqmatchallCommandline API and Usage Example

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Emboss.Applications

Detailed API documentation for the SeqmatchallCommandline class, including its constructor, base class, and properties. An example demonstrates how to instantiate and configure the command-line object for the 'seqmatchall' EMBOSS program.

```APIDOC
class Bio.Emboss.Applications.SeqmatchallCommandline(cmd='seqmatchall', **kwargs)
  Bases: _EmbossCommandLine
  Description: Commandline object for the seqmatchall program from EMBOSS.

  Methods:
    __init__(cmd='seqmatchall', **kwargs)
      Description: Initialize the class.

  Properties:
    - aformat (string): Display output in a different specified output format. This controls the addition of the -aformat parameter and its associated value. Set this property to the argument value required.
    - auto (boolean): Turn off prompts. Automatic mode disables prompting, so we recommend you set this argument all the time when calling an EMBOSS tool from Biopython. This property controls the addition of the -auto switch, treat this property as a boolean.
    - debug (boolean): Write debug output to program.dbg. This property controls the addition of the -debug switch, treat this property as a boolean.
    - die (boolean): Report dying program messages. This property controls the addition of the -die switch, treat this property as a boolean.
    - error (boolean): Report errors. This property controls the addition of the -error switch, treat this property as a boolean.
    - filter (boolean): Read standard input, write standard output. This property controls the addition of the -filter switch, treat this property as a boolean.
```

```python
cline = SeqmatchallCommandline(sequence="opuntia.fasta", outfile="opuntia.txt")
cline.auto = True
cline.wordsize = 18
cline.aformat = "pair"
print(cline)
```

--------------------------------

### FastTreeCommandline __init__ Method Documentation

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Phylo.Applications

Documentation for the `__init__` method of the Bio.Phylo.Applications.FastTreeCommandline class, explaining its initialization parameters.

```APIDOC
__init__(cmd='fasttree', **kwargs)
  Initialize the class.
```

--------------------------------

### Install Biopython on Fedora using yum

Source: https://biopython.org/wiki/Documentation/wiki/Packages

Install Biopython for Python 2 or Python 3 on Fedora systems using the yum package manager.

```Shell
yum install python-biopython
```

```Shell
yum install python3-biopython
```

--------------------------------

### Test Biopython Genepop EasyController Installation

Source: https://biopython.org/wiki/Documentation/wiki/PopGen_Genepop

This snippet demonstrates how to test the Biopython Genepop EasyController installation. It initializes an `EasyController` instance with a Genepop formatted file and attempts to retrieve basic information. An `IOError` indicates that the Genepop executable is not found.

```python
from Bio.PopGen.GenePop.EasyController import EasyController

ctrl = EasyController(your_file_here)
print(ctrl.get_basic_info())
```

--------------------------------

### Get Help for Biopython's qblast Function

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_blast

Shows how to use Python's built-in `help()` function to view the documentation and available arguments for the `Bio.Blast.qblast` function directly within the interpreter.

```python
from Bio import Blast
help(Blast.qblast)
```

--------------------------------

### Install or update Biopython using Conda

Source: https://biopython.org/wiki/Documentation/wiki/Packages

Install or update Biopython using the Conda package manager from the conda-forge channel. This is recommended for users with Conda environments.

```Shell
conda install -c conda-forge biopython
```

```Shell
conda update -c conda-forge biopython
```

--------------------------------

### Example Sanger FASTQ File Content

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.SeqIO.QualityIO

A short example of a FASTQ file demonstrating the Sanger convention with PHRED style qualities and an ASCII offset of 33. It contains three reads.

```text
@EAS54_6_R1_2_1_413_324
CCCTTCTTGTCTTCAGCGTTTCTCC
+
;;3;;;;;;;;;;;;7;;;;;;;88
@EAS54_6_R1_2_1_540_792
TTGGCAGGCCAAGGCCGATGGATCA
+
;;;;;;;;;;;7;;;;;-;;;3;83
@EAS54_6_R1_2_1_443_348
GTTGCTTCTGGCGTGGGTGGGGGGG
+
;;;;;;;;;;;9;7;;.7;393333
```

--------------------------------

### Example GenBank File Header

Source: https://biopython.org/wiki/Documentation/wiki/SeqIO

Provides an example of the typical header content found in a GenBank file, including LOCUS, DEFINITION, ACCESSION, and VERSION fields.

```Text
LOCUS       ATCOR66M      513 bp    mRNA            PLN       02-MAR-1992
DEFINITION  A.thaliana cor6.6 mRNA.
ACCESSION   X55053
VERSION     X55053.1  GI:16229
...
```

--------------------------------

### Get Aligned Subsequences with alignment.aligned in Biopython

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Align

This snippet demonstrates how to use the `aligned` property of a `Bio.Align.Alignment` object to retrieve the start and end indices of aligned subsequences. It shows examples with different gap placements and how the property reflects the aligned regions, even when alignments differ only by gap positions.

```python
>>> alignment.aligned
array([[[0, 2],
        [4, 5]],

       [[0, 2],
        [2, 3]]])
>>> alignment = alignments[1]
>>> print(alignment)
target            0 GAACT 5
                  0 |-|-| 5
query             0 G-A-T 3

>>> alignment.aligned
array([[[0, 1],
        [2, 3],
        [4, 5]],

       [[0, 1],
        [1, 2],
        [2, 3]]])
```

```python
>>> aligner.mismatch_score = -10
>>> alignments = aligner.align("AAACAAA", "AAAGAAA")
>>> len(alignments)
2
>>> print(alignments[0])
target            0 AAAC-AAA 7
                  0 |||--||| 8
query             0 AAA-GAAA 7

>>> alignments[0].aligned
array([[[0, 3],
        [4, 7]],

       [[0, 3],
        [4, 7]]])
>>> print(alignments[1])
target            0 AAA-CAAA 7
                  0 |||--||| 8
query             0 AAAG-AAA 7

>>> alignments[1].aligned
array([[[0, 3],
        [4, 7]],

       [[0, 3],
        [4, 7]]])
```

--------------------------------

### Ensure pip is installed for Python

Source: https://biopython.org/wiki/Documentation/wiki/Download

Verifies and installs the pip package manager for Python if it's not already present. This is a prerequisite for using pip to manage Python packages.

```Bash
python -m ensurepip
```

--------------------------------

### Update Biopython using pip

Source: https://biopython.org/wiki/Documentation/wiki/Download

Upgrades an existing Biopython installation to the latest version. This command also removes older versions of Biopython and NumPy before installing the new ones.

```Bash
pip install biopython --upgrade
```

--------------------------------

### Access Biopython qblast Function Documentation

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_blast

Shows how to use Python's built-in `help()` function to view the documentation for the `NCBIWWW.qblast` function, providing details on its arguments and usage.

```python
from Bio.Blast import NCBIWWW
help(NCBIWWW.qblast)
```

--------------------------------

### Build and Test Biopython Distribution

Source: https://biopython.org/wiki/Documentation/wiki/Building_a_release

Execute the `setup.py` script to build the Biopython distribution and then run its comprehensive test suite to verify functionality before the release. Note that running tests simultaneously with multiple Python versions is risky due to potential file conflicts.

```Shell
drevil:~biopython> python setup.py build
drevil:~biopython> python setup.py test
```

--------------------------------

### Install Biopython for specific Python interpreters

Source: https://biopython.org/wiki/Documentation/wiki/Download

Installs Biopython using pip for a particular Python version or interpreter, such as Python 3.13 or PyPy. This is useful when multiple Python environments are present.

```Bash
python3.13 -m pip install biopython
pypy -m pip install biopython
```

--------------------------------

### API Documentation for FSeqBootCommandline Class

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Emboss

Documents the `FSeqBootCommandline` class, part of Biopython's `Bio.Emboss.Applications` module. It outlines the constructor and various properties/methods for configuring the FSeqBoot command-line tool.

```APIDOC
FSeqBootCommandline:
  __init__()
  auto
  blocksize
  catergories
  debug
  die
  dotdiff
  error
  filter
  fracsample
  help
  jusweights
  options
```

--------------------------------

### Uninstall Biopython using pip

Source: https://biopython.org/wiki/Documentation/wiki/Download

Removes the Biopython package from your Python environment. Use this command if you no longer need Biopython installed.

```Bash
pip uninstall biopython
```

--------------------------------

### Clone Biopython Repository for Release Preparation

Source: https://biopython.org/wiki/Documentation/wiki/Building_a_release

This snippet shows how to clone the Biopython Git repository into a temporary directory and navigate into it, preparing the environment for subsequent build and distribution steps.

```bash
git clone https://github.com/biopython/biopython.git
cd biopython
```

--------------------------------

### BWA Samse Command Line Syntax Example

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Sequencing.Applications

Illustrates the basic command-line syntax for the BWA `samse` tool, showing required input files and optional parameters for generating SAM output.

```bash
$ bwa samse [-n maxOcc] <in.db.fasta> <in.sai> <in.fq> > <out.sam>
```

--------------------------------

### Biopython Fasta Module: Deprecation and Removal

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_introduction

Informs users that the `Bio.Fasta` module was deprecated in Biopython 1.51 (August 2009) and subsequently removed in Biopython 1.55 (August 2010). Directs users to the `DEPRECATED.rst` file for examples on converting old code to use `Bio.SeqIO` instead.

```APIDOC
Bio.Fasta
```

--------------------------------

### Construct and Print Complete Bio.Application.AbstractCommandline

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Application

Provides a comprehensive example of setting all necessary parameters for a `WaterCommandline` object and then converting it into a complete command-line string suitable for execution.

```Python
from Bio.Emboss.Applications import WaterCommandline
water_cmd = WaterCommandline(gapopen=10, gapextend=0.5)
water_cmd.asequence = "asis:ACCCGGGCGCGGT"
water_cmd.bsequence = "asis:ACCCGAGCGCGGT"
water_cmd.outfile = "temp_water.txt"
print(water_cmd)
water_cmd
```

--------------------------------

### Install Perl on Debian/Ubuntu

Source: https://biopython.org/wiki/Documentation/wiki/BioSQL

This command installs the Perl interpreter on Debian or Ubuntu Linux distributions. Perl is required to run some of the BioSQL setup scripts.

```Shell
sudo apt-get install perl
```

--------------------------------

### BWA MEM Command Line Syntax Example

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Sequencing.Applications

Illustrates the typical shell command syntax for running BWA MEM, showing input and output file conventions for alignment.

```Shell
$ bwa mem [...] <in.db.fasta> <in1.fq> <in2.fq> > <out.sam>
```

--------------------------------

### Renumbering Residues in Biopython PDB Structure

Source: https://biopython.org/wiki/Documentation/wiki/GSOC2010_Joao

This example demonstrates how to renumber residues within a Biopython PDB structure. The `renumber_residues()` method adjusts the residue numbering to start from 1 (by default), while preserving information about gaps. It can also accept a `start` argument to set a custom starting number.

```Python
from Bio.PDB import PDBParser

p = PDBParser()
s = p.get_structure("example", "1IHM.pdb")

print(list(s.get_residues())[0])
# <Residue ASP het=  resseq=1029 icode= >

s.renumber_residues()
print(list(s.get_residues())[0])
# <Residue ASP het=  resseq=1 icode= >
```

--------------------------------

### Biopython SeqIO: Using index_db Function

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_introduction

Explains that the `Bio.SeqIO.index_db()` function requires Biopython 1.57 or later and a Python installation with SQLite3 support. Earlier versions of Biopython do not include this function.

```APIDOC
Bio.SeqIO.index_db(filename, format)
```

--------------------------------

### Execute PAML Codeml with Biopython wrapper

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_phylo

This example illustrates the typical workflow for using Biopython's `Bio.Phylo.PAML.codeml` wrapper. It demonstrates initializing the Codeml object, setting input files (alignment, tree), specifying output and working directories, configuring runtime options via `set_options`, running the analysis, and accessing the parsed results.

```Python
>>> from Bio.Phylo.PAML import codeml
>>> cml = codeml.Codeml()
>>> cml.alignment = "Tests/PAML/Alignments/alignment.phylip"
>>> cml.tree = "Tests/PAML/Trees/species.tree"
>>> cml.out_file = "results.out"
>>> cml.working_dir = "./scratch"
>>> cml.set_options(
...     seqtype=1,
...     verbose=0,
...     noisy=0,
...     RateAncestor=0,
...     model=0,
...     NSsites=[0, 1, 2],
...     CodonFreq=2,
...     cleandata=1,
...     fix_alpha=1,
...     kappa=4.54006,
... )
>>> results = cml.run()
>>> ns_sites = results.get("NSsites")
>>> m0 = ns_sites.get(0)
>>> m0_params = m0.get("parameters")
>>> print(m0_params.get("omega"))
```

--------------------------------

### Build Biopython RPM Package

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_contributing

This command demonstrates how to build a platform-specific RPM package and a source RPM for Biopython using the `setup.py` script. The resulting packages will be placed in the `dist` directory. A C compiler is essential for this process.

```Shell
$ python setup.py bdist_rpm
```

--------------------------------

### Constructing and Executing Primer3Commandline

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Emboss.Applications

Demonstrates how to initialize `Primer3Commandline` with various parameters, set boolean flags and numeric options, and shows the resulting command-line string. It also illustrates the `ValueError` raised for invalid parameters.

```python
cline = Primer3Commandline(sequence="mysequence.fas", auto=True, hybridprobe=True)
cline.explainflag = True
cline.osizeopt=20
cline.psizeopt=200
cline.outfile = "myresults.out"
cline.bogusparameter = 1967  # Invalid parameter
Traceback (most recent call last):
    ...
ValueError: Option name bogusparameter was not found.
print(cline)
eprimer3 -auto -outfile=myresults.out -sequence=mysequence.fas -hybridprobe=True -psizeopt=200 -osizeopt=20 -explainflag=True
```

--------------------------------

### Get Start and End Indices with get_start_end() in Bio.Nexus.Nexus

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Nexus

This snippet documents the `get_start_end()` function. It is used to determine the start and end indices within a sequence or data range, often employed in parsing or slicing operations.

```APIDOC
get_start_end()
```

--------------------------------

### PHYLIP Format: Example Output with Modified Identifiers

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_msa

This block displays an example of the strict PHYLIP format output generated after the sequence identifiers have been compressed and renamed. It highlights the fixed-width format and the simplified identifiers, along with the continuation lines for longer sequences.

```Text
 7 52
seq0       AEPNAATNYA TEAMDSLKTQ AIDLISQTWP VVTTVVVAGL VIRLFKKFSS
seq1       AEPNAATNYA TEAMDSLKTQ AIDLISQTWP VVTTVVVAGL VIKLFKKFVS
seq2       DGTSTATSYA TEAMNSLKTQ ATDLIDQTWP VVTSVAVAGLAIRLFKKFSS
seq3       AEGDDP---A KAAFNSLQAS ATEYIGYAWA MVVVIVGATIGIKLFKKFTS
seq4       AEGDDP---A KAAFDSLQAS ATEYIGYAWA MVVVIVGATIGIKLFKKFAS
seq5       AEGDDP---A KAAFDSLQAS ATEYIGYAWA MVVVIVGATIGIKLFKKFTS
seq6       FAADDATSQA KAAFDSLTAQ ATEMSGYAWA LVVLVVGATV GIKLFKKFVS

           KA
           RA
           KA
           KA
           KA
           KA
           RA
```

--------------------------------

### Load Starting Tree with Bio.Phylo

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Phylo.TreeConstruction

Illustrates loading an existing phylogenetic tree from a Newick file using `Bio.Phylo.read`. This tree can serve as a starting point for tree construction algorithms.

```Python
starting_tree = Phylo.read('TreeConstruction/nj.tre', 'newick')
print(starting_tree)
```

--------------------------------

### Create SimpleLocation Objects in Biopython

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.SeqFeature

Provides examples of instantiating `SimpleLocation` objects with different start, end, and strand values, demonstrating how the object represents the location and how its attributes (`start`, `end`, `strand`) are accessed. It highlights the zero-based indexing and the handling of forward and reverse strands.

```python
from Bio.SeqFeature import SimpleLocation
f = SimpleLocation(122, 150)
print(f)
print(f.start)
print(f.end)
print(f.strand)
```

```python
from Bio.SeqFeature import SimpleLocation
f = SimpleLocation(122, 150, strand=+1)
print(f)
print(f.strand)
```

```python
from Bio.SeqFeature import SimpleLocation
r = SimpleLocation(122, 150, strand=-1)
print(r)
print(r.start)
print(r.end)
print(r.strand)
```

--------------------------------

### Get Length of Biopython SeqFeature or Location

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_seq_annot

This example shows how to determine the length of a SeqFeature or SimpleLocation object. It highlights that the length corresponds to the described sequence region and for CompoundLocation objects, it's the sum of constituent regions, using objects defined in prior examples.

```Python
print(len(feature_seq))
print(len(feature))
print(len(feature.location))
```

--------------------------------

### Biopython Command Line Tools: Application Wrappers

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_introduction

Discusses the deprecation of direct command-line tool execution from Biopython application wrappers (deprecated in 1.78, available from 1.55). Recommends using Python's `subprocess` module directly for running external commands.

```APIDOC
subprocess.run(...)
```

--------------------------------

### Get Length of SimpleLocation Object

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.SeqFeature

Illustrates how to obtain the length of the region described by a SimpleLocation object, including examples with fuzzy locations.

```python
>>> from Bio.SeqFeature import SimpleLocation
>>> from Bio.SeqFeature import BeforePosition, AfterPosition
>>> loc = SimpleLocation(BeforePosition(5), AfterPosition(10))
>>> len(loc)
5
```

--------------------------------

### TRANSFAC File Example with Multiple Motifs

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_motifs

This example demonstrates a TRANSFAC file containing multiple motifs, showing the general structure for files with more than one motif entry, including version information.

```text
VV  EXAMPLE January 15, 2013
XX
//
ID  motif1
P0      A      C      G      T
01      1      2      2      0      S
02      2      1      2      0      R
03      3      0      1      1      A
...
11      0      2      0      3      Y
12      1      0      3      1      G
//
ID  motif2
P0      A      C      G      T
01      2      1      2      0      R
02      1      2      2      0      S
...
09      0      0      0      5      T
10      0      2      0      3      Y
//
```

--------------------------------

### Example FASTA File Content

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_seq_annot

This block shows the initial lines of the example FASTA file used throughout the documentation. It contains a single sequence record for Yersinia pestis plasmid pPCP1, demonstrating the standard FASTA header and sequence format.

```text
>gi|45478711|ref|NC_005816.1| Yersinia pestis biovar Microtus ... pPCP1, complete sequence
TGTAACGAACGGTGCAATAGTGATCCACACCCAACGCCTGAAATCAGATCCAGGGGGTAATCTGCTCTCC
...
```

--------------------------------

### Accessing Help Documentation for Bio.SeqIO.convert

Source: https://biopython.org/wiki/Documentation/docs/latest/Tutorial/chapter_seqio

Illustrates how to use Python's built-in `help()` function to view the documentation for the `Bio.SeqIO.convert` function, providing details on its usage, parameters, and behavior directly within the Python interpreter.

```python
>>> from Bio import SeqIO
>>> help(SeqIO.convert)
```

--------------------------------

### Example Usage of Bio.Data.CodonTable.__str__

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Data.CodonTable

Demonstrates how to use the `__str__` method of the `CodonTable` class to get a formatted string representation of standard DNA and generic codon tables.

```Python
>>> import Bio.Data.CodonTable
>>> print(Bio.Data.CodonTable.standard_dna_table)
Table 1 Standard, SGC0

  |  T      |  C      |  A      |  G      |
--+---------+---------+---------+---------+--
T | TTT F   | TCT S   | TAT Y   | TGT C   | T
T | TTC F   | TCC S   | TAC Y   | TGC C   | C
...
G | GTA V   | GCA A   | GAA E   | GGA G   | A
G | GTG V   | GCG A   | GAG E   | GGG G   | G
--+---------+---------+---------+---------+--
>>> print(Bio.Data.CodonTable.generic_by_id[1])
Table 1 Standard, SGC0

  |  U      |  C      |  A      |  G      |
--+---------+---------+---------+---------+--
U | UUU F   | UCU S   | UAU Y   | UGU C   | U
U | UUC F   | UCC S   | UAC Y   | UGC C   | C
...
G | GUA V   | GCA A   | GAA E   | GGA G   | A
G | GUG V   | GCG A   | GAG E   | GGG G   | G
--+---------+---------+---------+---------+--
```

--------------------------------

### Bio.Sequencing.Applications.SamtoolsMpileupCommandline API Reference

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.Sequencing.Applications

This section provides the API documentation for the SamtoolsMpileupCommandline class, detailing its constructor and initial properties that correspond to `samtools mpileup` command-line options. Each property controls the addition of a specific parameter or switch to the command.

```APIDOC
Bio.Sequencing.Applications.SamtoolsMpileupCommandline:
  Bases: Bio.Application.AbstractCommandline
  Description: Command line wrapper for samtools mpileup.
    Generate BCF or pileup for one or multiple BAM files, equivalent to:
    $ samtools mpileup [-EBug] [-C capQcoef] [-r reg] [-f in.fa]
                       [-l list] [-M capMapQ] [-Q minBaseQ]
                       [-q minMapQ] in.bam [in2.bam [...]]
  __init__(cmd='samtools', **kwargs)
    Description: Initialize the class.
  Properties:
    A:
      Description: Do not skip anomalous read pairs in variant calling.
        This property controls the addition of the -A switch, treat this property as a boolean.
    B:
      Description: Disable probabilistic realignment for the computation of base alignment quality (BAQ).
        This property controls the addition of the -B switch, treat this property as a boolean.
```

--------------------------------

### Example GenBank CDS Feature Data

Source: https://biopython.org/wiki/Documentation/docs/latest/api/Bio.GenBank.Scanner

An example of a GenBank CDS (Coding Sequence) feature entry, illustrating the structure including location, locus tag, notes, codon start, translation table, product, protein ID, database cross-references, and the translated protein sequence. This format is parsed by the `parse_feature` method.

```Text
CDS             complement(join(490883..490885,1..879))
                /locus_tag="NEQ001"
                /note="conserved hypothetical [Methanococcus jannaschii];
                COG1583:Uncharacterized ACR; IPR001472:Bipartite nuclear
                localization signal; IPR002743: Protein of unknown
                function DUF57"
                /codon_start=1
                /transl_table=11
                /product="hypothetical protein"
                /protein_id="NP_963295.1"
                /db_xref="GI:41614797"
                /db_xref="GeneID:2732620"
                /translation="MRLLLELKALNSIDKKQLSNYLIQGFIYNILKNTEYSWLHNWKK
                EKYFNFTLIPKKDIIENKRYYLIISSPDKRFIEVLHNKIKDLDIITIGLAQFQLRKTK
                KFDPKLRFPWVTITPIVLREGKIVILKGDKYYKVFVKRLEELKKYNLIKKKEPILEEP
                IEISLNQIKDGWKIIDVKDRYYDFRNKSFSAFSNWLRDLKEQSLRKYNNFCGKNFYFE
                EAIFEGFTFYKTVSIRIRINRGEAVYIGTLWKELNVYRKLDKEEREFYKFLYDCGLGS
                LNSMGFGFVNTKKNSAR"
```

=== COMPLETE CONTENT === This response contains all available snippets from this library. No additional content exists. Do not make further requests.